The Ribosomal_S13_N domain within your query sequence starts at position 1 and ends at position 60, and its E-value is 1.18e-36.

MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGV
Ribosomal_S13_N

Ribosomal_S13_N

Ribosomal S13/S15 N-terminal domain
SMART ACC:SM001386
Description:This domain is found at the N-terminus of ribosomal S13 and S15 proteins. This domain is also identified as NUC021 (PMID:15112237).
InterPro ACC:IPR012606
InterPro abstract:

This domain is found at the N terminus of ribosomal uS15 proteins.

Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers … expand

GO process:translation (GO:0006412)
GO component:ribosome (GO:0005840)
GO function:structural constituent of ribosome (GO:0003735)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 408 Ribosomal_S13_N domains in 2 402 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Ribosomal_S13_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Ribosomal_S13_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

Relevant references for this domain

Primary literature for the Ribosomal_S13_N domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Ribosomal_S13_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing Ribosomal_S13_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamRibosomal_S13_N
InterProIPR012606