The ARF domain within your query sequence starts at position 1 and ends at position 185, and its E-value is 2.25e-31.

MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLAGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR
ARF

ARF

ARF-like small GTPases; ARF, ADP-ribosylation factor
SMART ACC:SM000177
Description:Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 12 028 ARF domains in 11 995 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ARF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ARF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:GTP hydrolysis

Relevant references for this domain

Primary literature for the ARF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ARF domain which could be assigned to a KEGG orthologous group, and not all proteins containing ARF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamarf