The NOSIC domain within your query sequence starts at position 161 and ends at position 213, and its E-value is 2.68e-29.

MIVQAISLLDDLDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGD
NOSIC

NOSIC

NOSIC (NUC001) domain
SMART ACC:SM000931
Description:This is the central domain in Nop56/SIK1-like proteins (PUBMED:15112237).
InterPro ACC:IPR012976
InterPro abstract:

This entry represents a domain centrally located in a group of pre-RNA processing ribonucleoproteins (RNPs), including the eukaryotic proteins Prp31, Nop56 and Nop58 and the archaeal homologue Nop5. This domain was named after the central domain in Nop56/SIK1-like proteins [ PUBMED:15112237 PUBMED:33495354 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 428 NOSIC domains in 5 423 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NOSIC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NOSIC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the NOSIC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NOSIC domain which could be assigned to a KEGG orthologous group, and not all proteins containing NOSIC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR012976
PfamNOSIC