The RWD domain within your query sequence starts at position 1 and ends at position 94, and its E-value is 6.36e-15.

MKGNGRSPWEIFITLHPATAEVQDSQFVCFTLVLRIPVQYPHEVPQISIRNPRGLSDEQIHKISQALGHVAKEGLGTAMLYELIEKGKEILTDN
RWD

RWD

SMART ACC:SM000591
Description:domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain
InterPro ACC:IPR006575
InterPro abstract:

The RWD domain is a conserved region of about 110 amino acid residues, which has been identified in the mouse GCN2 eIF2alpha kinase and histidyl-tRNA synthetase and in presumed orthologues in other eukaryotic species from yeast to vertebrates. Additionally, it is also found in WD repeat containing proteins, yeast DEAD (DEXD)-like helicases, many RING-finger containing proteins, the UPF0029 uncharacterised … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 749 RWD domains in 9 719 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RWD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RWD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the RWD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RWD domain which could be assigned to a KEGG orthologous group, and not all proteins containing RWD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006575