The SH3 domain within your query sequence starts at position and ends at position , and its E-value is < 1e-12.

MLKNFKLSKRDSNGSKGRITSADISTPSHDNGSVIKHIKTVPVRYLSSSSTPVKSQRDSSPKNRHNSKDIT
SH3

SH3

Src homology 3 domains
SMART ACC:SM000326
Description:Src homology 3 (SH3) domains bind to target proteins through sequences containing proline and hydrophobic amino acids. Pro-containing polypeptides may bind to SH3 domains in 2 different binding orientations.
InterPro ACC:IPR001452
InterPro abstract:

SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [ PUBMED:15335710 PUBMED:11256992 ]. They are found in a great variety of intracellular or membrane-associated proteins [ expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 197 921 SH3 domains in 149 315 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SH3 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SH3 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Protein-binding, proline-rich peptide-binding

Relevant references for this domain

Primary literature for the SH3 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the SH3 domain.

ProteinDescriptionDisease / phenotype
MYO7A_HUMANOMIM:276903 : Usher syndrome, type 1B ; Deafness, autosomal recessive 2, neurosensory
OMIM:600060 : Deafness, autosomal dominant 11, neurosensory
OMIM:601317 : no description
PEX13_HUMANOMIM:601789 : Zellweger syndrome
OMIM:214100 : Adrenoleukodystrophy, neonatal
OMIM:202370 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SH3 domain which could be assigned to a KEGG orthologous group, and not all proteins containing SH3 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITESH3
InterProIPR001452
PfamSH3