The RasGEF domain within your query sequence starts at position 571 and ends at position 853, and its E-value is 3.88e-84.

MLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLDSKTGNTHLKQFEDIVNQETFWVASEILSESNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRGTWEKLPSKYEKHLQDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDMTFLHEGNDSKVDGLVNFEKLRMIAKEIRHIIRMTSANMDPAMMFRQRSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDIDTDEEKFQMMSLQWEPAY
RasGEF

RasGEF

Guanine nucleotide exchange factor for Ras-like small GTPases
SMART ACC:SM000147
Description: -
InterPro ACC:IPR001895
InterPro abstract:

This entry represents the catalytic domain of the Ras guanine-nucleotide exchange factors.

Ras proteins are membrane-associated molecular switches that bind GTP and GDP and slowly hydrolyze GTP to GDP [ PUBMED:1898771 ] in fundamental events such as signal transduction, cytoskeleton dynamics and intracellular … expand

GO process:small GTPase-mediated signal transduction (GO:0007264)
GO function:guanyl-nucleotide exchange factor activity (GO:0005085)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 18 332 RasGEF domains in 18 317 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RasGEF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RasGEF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis: protein-binding, Ras-binding, guanine nucleotide exchange activity towards Ras

Relevant references for this domain

Primary literature for the RasGEF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RasGEF domain which could be assigned to a KEGG orthologous group, and not all proteins containing RasGEF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEGDS_CDC25
InterProIPR001895
PfamRasGEF