The ENDO3c domain within your query sequence starts at position 107 and ends at position 259, and its E-value is 1.46e-52.

MLQQTQVATVIDYYTRWMQKWPKLQDLASASLEEVNQLWSGLGYYSRGRRLQEGARKVVEELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFDQVTGVVDGNVLRVLCRVRAIGADPTSTLVSHHLWNLAQQLVDPARPGDFNQAAMELGAT
ENDO3c

ENDO3c

endonuclease III
SMART ACC:SM000478
Description:includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases
InterPro ACC:IPR003265
InterPro abstract:

The HhH-GPD superfamily gets its name from its hallmark helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate [ PUBMED:10706276 PUBMED:8805338 ]. This domain is found in a diverse range of structurally related DNA repair … expand

GO process:base-excision repair (GO:0006284)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 64 550 ENDO3c domains in 64 538 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ENDO3c domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ENDO3c domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ENDO3c domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the ENDO3c domain.

ProteinDescriptionDisease / phenotype
OGG1_HUMANOMIM:601982 : Renal cell carcinoma, clear cell
OMIM:144700 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ENDO3c domain which could be assigned to a KEGG orthologous group, and not all proteins containing ENDO3c domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITE ENDONUCLEASE_III_2
InterProIPR003265
PfamAlkA_DNA_repair