The Agouti domain within your query sequence starts at position 1 and ends at position 118, and its E-value is 1.2e-54.

MLTAMLLSCVLLLALPPTLGVQMGVAPLKGIRRPDQALFPEFPGLSLNGLKKTTADRAEEVLLQKAEALAEVLDPQNRESRSPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYC
Agouti

Agouti

Agouti protein
SMART ACC:SM000792
Description:The agouti protein regulates pigmentation in the mouse hair follicle producing a black hair with a subapical yellow band. A highly homologous protein agouti signal protein (ASIP) is present in humans and is expressed at highest levels in adipose tissue where it may play a role in energy homeostasis and possibly human pigmentation (PUBMED:11837451), (PUBMED:11833005).
InterPro ACC:IPR007733
InterPro abstract:

The agouti protein regulates pigmentation in the mouse hair follicle producing a black hair with a subapical yellow band. A highly homologous protein agouti signal protein (ASIP) is present in humans and is expressed at highest levels in adipose tissue where it may play a role in energy homeostasis and possibly human pigmentation [ PUBMED:11837451 expand

GO process:hormone-mediated signaling pathway (GO:0009755)
GO component:extracellular region (GO:0005576)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 669 Agouti domains in 669 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Agouti domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Agouti domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the Agouti domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Agouti domain which could be assigned to a KEGG orthologous group, and not all proteins containing Agouti domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamAgouti
InterProIPR007733