The MyTH4 domain within your query sequence starts at position 844 and ends at position 990, and its E-value is 1.8e-42.

MLTVPLKMPLTRLPVEHHAEAISVFKLILRFMGDPHLHGTQEMILGNYIVHQGLVEPALRDEILAQLANQVWRNPNAYNSKRGWLLLAACLSGFAPSPHLDKFLLKFVSDYGQNGFQAVCQHRLLQAMGSGAARTFPPTQLEWTAIQ
MyTH4

MyTH4

Domain in Myosin and Kinesin Tails
SMART ACC:SM000139
Description:Domain present twice in myosin-VIIa, and also present in 3 other myosins.
InterPro ACC:IPR000857
InterPro abstract:

The microtubule-based kinesin motors and actin-based myosin motors generate movements required for intracellular trafficking, cell division, and muscle contraction. In general, these proteins consist of a motor domain that generates movement and a tail region that varies widely from class to class and is thought to mediate many of the regulatory or cargo binding functions specific to each class … expand

GO component:cytoskeleton (GO:0005856)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 247 MyTH4 domains in 3 186 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MyTH4 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MyTH4 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Unknown

Relevant references for this domain

Primary literature for the MyTH4 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the MyTH4 domain.

ProteinDescriptionDisease / phenotype
MYO7A_HUMANOMIM:276903 : Usher syndrome, type 1B ; Deafness, autosomal recessive 2, neurosensory
OMIM:600060 : Deafness, autosomal dominant 11, neurosensory
OMIM:601317 : no description
MYO15_HUMANOMIM:602666 : Deafness, autosomal recessive 3
OMIM:600316 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MyTH4 domain which could be assigned to a KEGG orthologous group, and not all proteins containing MyTH4 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000857