The CDC48_N domain within your query sequence starts at position 44 and ends at position 135, and its E-value is 2.47e-1.

MLVVTNFLEKDGKVPKTFQNSLVHLGLNTMKSANICIGRPVLLTSLDGKQEVYTAWPVAGFPGGKVGLSEMAQKNVGVRAGETIQVQPLLGA
CDC48_N

CDC48_N

Cell division protein 48 (CDC48) N-terminal domain
SMART ACC:SM001073
Description:This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains. Both the VAT and NSF N-terminal functional domains consist of two structural domains of which this is at the N-terminus. The VAT-N domain found in AAA ATPases is a substrate 185-residue recognition domain (PUBMED:10531028).
InterPro ACC:IPR003338
InterPro abstract:

This entry represents the amino-terminal subdomain.

The CDC48 N-terminal domain is a protein domain found in AAA ATPases including cell division protein 48 (CDC48), VCP-like ATPase (VAT) and N-ethylmaleimide sensitive fusion protein. It is a substrate recognition domain which binds polypeptides, prevents protein aggregation, and catalyses refolding of permissive substrates. It is composed … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 871 CDC48_N domains in 6 866 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CDC48_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CDC48_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the CDC48_N domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CDC48_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing CDC48_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003338
PfamCDC48_N