The Lactamase_B domain within your query sequence starts at position 1 and ends at position 175, and its E-value is 2.06e0.

MNGVVIPQTPIAVDFWSLRRAGSARLFFLTHMHCDHTVGLSSTWARPLYCSPITACLLHRRLQVSKHWIRALEVGESHVLPLDEIGQETMTVTLIDANHCPGSVMFLFEGYFGTILYTGDFRYTPSMLKEPALILGKQIHTLYLDNTNCNPALVLPSRQEATQQIVQLIRQFPQH
Lactamase_B

Lactamase_B

Metallo-beta-lactamase superfamily
SMART ACC:SM000849
Description:Apart from the beta-lactamases a number of other proteins contain this domain (PUBMED:7588620). These proteins include thiolesterases, members of the glyoxalase II family, that catalyse the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid and a competence protein that is essential for natural transformation in Neisseria gonorrhoeae and could be a transporter involved in DNA uptake. Except for the competence protein these proteins bind two zinc ions per molecule as cofactor.
InterPro ACC:IPR001279
InterPro abstract:

Metallo beta lactamases exhibit low sequence identity between enzymes but they are structurally similar. They have a characteristic α-β/β-α sandwich fold in which the active site is at the interface between domains. Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain and share the same fold type [ PUBMED:7588620 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 264 030 Lactamase_B domains in 263 820 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Lactamase_B domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Lactamase_B domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the Lactamase_B domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Lactamase_B domain which could be assigned to a KEGG orthologous group, and not all proteins containing Lactamase_B domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamLactamase_B
InterProIPR001279