The Alpha_L_fucos domain within your query sequence starts at position 1 and ends at position 95, and its E-value is 1.15e-6.

MNNNYAPGFKYEDFVVLFTAKYFNANQWADILQASGAKYVVFTSKHHEGFTMWGSDRSWNWNAVDEGPKRDIVKELEVAVRNRTGLHFGLYYSLF
Alpha_L_fucos

Alpha_L_fucos

Alpha-L-fucosidase
SMART ACC:SM000812
Description:O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site PUBMED:. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
InterPro ACC:IPR000933
InterPro abstract:

O-Glycosyl hydrolases family 29 encompasses alpha-L-fucosidases ( EC:3.2.1.51 ) [ PUBMED:2482732 ], which is a lysosomal enzyme responsible for hydrolysing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate … expand

GO process:carbohydrate metabolic process (GO:0005975)
GO function:alpha-L-fucosidase activity (GO:0004560)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 13 818 Alpha_L_fucos domains in 13 805 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Alpha_L_fucos domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Alpha_L_fucos domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the Alpha_L_fucos domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Alpha_L_fucos domain which could be assigned to a KEGG orthologous group, and not all proteins containing Alpha_L_fucos domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamAlpha_L_fucos
InterProIPR000933