The MYSc domain within your query sequence starts at position 80 and ends at position 786, and its E-value is < 1e-12.

MNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGDKKKEEATSGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQITSNKKPELIEMLLITTNPYDYPFVSQGEISVASIDDQEELMATDSAIDILGFTNDEKVSIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLQGLNSADLLKALCYPRVKVGNEYVTKGQTVEQVTNAVGALAKAMYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHLGKSANFQKPKVVKGKAEAHFSLIHYAGTVDYNITGWLDKNKDPLNETVVGLYQKSSVKTLAYLFSGAQTAEAEASSGGAAKKGAKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQYIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDD
MYSc

MYSc

Myosin. Large ATPases.
SMART ACC:SM000242
Description:ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
InterPro ACC:IPR001609
InterPro abstract:

Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril. Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [ PUBMED:1939027 ], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular … expand

GO component:myosin complex (GO:0016459)
GO function:ATP binding (GO:0005524), cytoskeletal motor activity (GO:0003774)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 33 491 MYSc domains in 33 449 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MYSc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MYSc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:ATP-hydrolysis, actin-binding

Relevant references for this domain

Primary literature for the MYSc domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the MYSc domain.

ProteinDescriptionDisease / phenotype
MYH9_HUMANOMIM:155100 : May-Hegglin anomaly
OMIM:160775 : May-Hegglin anomaly
OMIM:155100 : Fechtner syndrome
OMIM:153640 : Sebastian syndrome
OMIM:605249 : Deafness, autosomal dominant 17
OMIM:603622 : no description
MYO7A_HUMANOMIM:276903 : Usher syndrome, type 1B ; Deafness, autosomal recessive 2, neurosensory
OMIM:600060 : Deafness, autosomal dominant 11, neurosensory
OMIM:601317 : no description
MYH7_HUMANOMIM:160760 : Cardiomyopathy, familial hypertrophic, 1
OMIM:192600 : ?Central core disease, one form

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MYSc domain which could be assigned to a KEGG orthologous group, and not all proteins containing MYSc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001609
Pfammyosin_head