The IRF domain within your query sequence starts at position 1 and ends at position 114, and its E-value is 6.75e-62.

MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPP
IRF

IRF

interferon regulatory factor
SMART ACC:SM000348
Description:interferon regulatory factor, also known as trytophan pentad repeat
InterPro ACC:IPR001346
InterPro abstract:

Viral infections induce the expression of type I interferons (IFN-alpha and IFN-beta) genes. The induction is due to the transcriptional activation of the IFN genes. Interferon regulatory factor I (IRF-1) is one of the transcription factors responsible for that activation. IRF-1 binds to an upstream regulatory cis element, known as the interferon consensus sequence (ICS), which is found in the … expand

GO function:transcription cis-regulatory region binding (GO:0000976)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 978 IRF domains in 3 974 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing IRF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing IRF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the IRF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a IRF domain which could be assigned to a KEGG orthologous group, and not all proteins containing IRF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamIRF
InterProIPR001346
PROSITEIRF