The Skp1 domain within your query sequence starts at position 1 and ends at position 112, and its E-value is 1.13e-64.

MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDI
Skp1

Skp1

Found in Skp1 protein family
SMART ACC:SM000512
Description:Family of Skp1 (kinetochore protein required for cell cycle progression) and elongin C (subunit of RNA polymerase II transcription factor SIII) homologues.
InterPro ACC:IPR001232
InterPro abstract:

This entry includes SKP1 and SKP1-like protein, elongin-C (also known as TCEB1). SKP1 is part of the E3 ubiquitin ligase complexes. Elongin-C has dual functions, works as a component of RNA polymerase II (Pol II) transcription elongation factor and as the substrate recognition subunit of a Cullin-RING E3 ubiquitin ligase [ PUBMED:25878247 expand

GO process:ubiquitin-dependent protein catabolic process (GO:0006511)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 589 Skp1 domains in 4 481 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Skp1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Skp1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Skp1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Skp1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Skp1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamSkp1
InterProIPR001232