The DBR1 domain within your query sequence starts at position 235 and ends at position 380, and its E-value is 8.27e-85.

MQHQATDKDQAGKETKFLALDKCLPHRDFLQVLEIEHDPSAPEYLEYDVEWLTVLRATDDLINVTGGLWNMPEDNGLHTRWDYSATEETMKEVMEKLNHDPKVPCNFTMTAACYDPSKPQTQVKLVHRINPQTTEFCAQLGITDIN
DBR1

DBR1

Lariat debranching enzyme, C-terminal domain
SMART ACC:SM001124
Description:This presumed domain is found at the C-terminus of lariat debranching enzyme. This domain is always found in association with Metallophos PF00149.
InterPro ACC:IPR007708
InterPro abstract:

This presumed domain is found at the C terminus of lariat debranching enzyme. This domain is always found in association with a metallo-phosphoesterase domain IPR004843. RNA lariat debranching enzyme is capable of digesting a variety of branched nucleic acid substrates and multicopy single-stranded DNAs. The … expand

GO process:mRNA processing (GO:0006397)
GO function:hydrolase activity, acting on ester bonds (GO:0016788)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 708 DBR1 domains in 1 705 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DBR1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DBR1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the DBR1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DBR1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DBR1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR007708
PfamDBR1