The LSM14 domain within your query sequence starts at position 1 and ends at position 62, and its E-value is 1.33e-12.

MQPKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSL
LSM14

LSM14

Scd6-like Sm domain
SMART ACC:SM001271
Description:The Scd6-like Sm domain is found in Scd6p from S. cerevisiae, Rap55 from the newt Pleurodeles walt, and its orthologs from fungi, animals, plants and apicomplexans PMID:15257761. The domain is also found in Dcp3p and the human EDC3/FLJ21128 protein where it is fused to the the Rossmanoid YjeF-N domain PMID: 15257761,15225602. In addition both EDC3 and Scd6p are found fused to the FDF domain PMID: 15257761,15225602.
InterPro ACC:IPR025609
InterPro abstract:

The Lsm14 N-terminal domain is a type of LSM domain found in Lsm14 proteins (also known as Rap55) [ PUBMED:17074753 PUBMED:18723115 ] and in the Saccharomyces cerevisiae homologue Scd6 [ PUBMED:15225602 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 439 LSM14 domains in 3 428 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LSM14 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LSM14 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LSM14 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LSM14 domain which could be assigned to a KEGG orthologous group, and not all proteins containing LSM14 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamLSM14
InterProIPR025609