The btg1 domain within your query sequence starts at position 1 and ends at position 108, and its E-value is 7.37e-64.

MRDEIATAVFFVTRLVKKHEKLSTQQIETFALKLMTILFEKYRGHWHPDCPSKGQAFRCIRINNNENKDPVLERACAESNVNFFHLGLPKEMTIWVDPYEVCCRYGEK
btg1

btg1

tob/btg1 family
SMART ACC:SM000099
Description:The tob/btg1 is a family of proteins that inhibit cell proliferation.
InterPro ACC:IPR002087
InterPro abstract:

This entry represents a conserved domain found in the N-terminal of the BTG family members (also known as anti-proliferative proteins). In mammals, BTG family comprises six proteins: BTG1, BTG2/PC3/Tis21, BTG3/ANA, BTG4/PC3B, Tob1/Tob and Tob2. They regulate cell cycle progression in a variety of cell types [ PUBMED:19746446 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 150 btg1 domains in 1 147 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing btg1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing btg1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the btg1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a btg1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing btg1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamAnti_proliferat
PROSITE BTG1_2
InterProIPR002087