The Dynein_light domain within your query sequence starts at position 1 and ends at position 88, and its E-value is 1.12e-60.

MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKS
Dynein_light

Dynein_light

Dynein light chain type 1
SMART ACC:SM001375
Description: -
InterPro ACC:IPR001372
InterPro abstract:

Dynein is a multisubunit microtubule-dependent motor enzyme that acts as the force generating protein of eukaryotic cilia and flagella. The cytoplasmic isoform of dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.

Dynein is composed of a number of ATP-binding large subunits (see IPR004273 expand

GO process:microtubule-based process (GO:0007017)
GO component:dynein complex (GO:0030286)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 882 Dynein_light domains in 4 751 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Dynein_light domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Dynein_light domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Dynein_light domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Dynein_light domain which could be assigned to a KEGG orthologous group, and not all proteins containing Dynein_light domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDynein_light
InterProIPR001372