The cwf21 domain within your query sequence starts at position 836 and ends at position 887, and its E-value is 6.31e-17.

MSEEKRAKLREIELKVMKFQDELESGKRPKKPGQSFQEQVEHYRDKLLQREK
cwf21

cwf21

SMART ACC:SM001115
Description:The cwf21 family is involved in mRNA splicing. It has been isolated as a subcomplex of the splicosome in Schizosaccharomyces pombe ((PUBMED:11884590)). The function of the cwf21 domain is to bind directly to the spliceosomal protein Prp8. Mutations in the cwf21 domain prevent Prp8 from binding ((PUBMED:19854871)). The structure of this domain has recently been solved which shows this domain to be composed of two alpha helices.
InterPro ACC:IPR013170
InterPro abstract:

The cwf21 domain is found in proteins involved in mRNA splicing. Proteins containing this domain have been isolated as a subcomplex of the splicosome in Schizosaccharomyces pombe (Fission yeast) [ PUBMED:11884590 ]. In yeast, this domain binds the protein Prp8p [ PUBMED:19854871 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 663 cwf21 domains in 2 663 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing cwf21 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing cwf21 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription
Binding / catalysis:Binds directly to the spliceosomal protein Prp8.

Relevant references for this domain

Primary literature for the cwf21 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a cwf21 domain which could be assigned to a KEGG orthologous group, and not all proteins containing cwf21 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamcwf21
InterProIPR013170