The Tim44 domain within your query sequence starts at position 296 and ends at position 445, and its E-value is 9.67e-36.

MSEVLTEILRVDPTFDKDHFLHQCETDIIPNILEAMISGELDILKDWCYEATYSQLAHPIQQAKALGFQFHSRILDISNVDLAMGKMMEQGPVLIVTFQAQVVMVIKNSKGEVYDGDPDKVQRMLYVWALCRDQEELNPYAAWRLLDISA
Tim44

Tim44

SMART ACC:SM000978
Description:Tim44 is an essential component of the machinery that mediates the translocation of nuclear-encoded proteins across the mitochondrial inner membrane (PUBMED:10430866). Tim44 is thought to bind phospholipids of the mitochondrial inner membrane both by electrostatic interactions and by penetrating the polar head group region (PUBMED:10430866).
InterPro ACC:IPR007379
InterPro abstract:

Tim44 is an essential component of the machinery that mediates the translocation of nuclear-encoded proteins across the mitochondrial inner membrane [ PUBMED:10430866 ]. Tim44 is thought to bind phospholipids of the mitochondrial inner membrane both by electrostatic interactions and by penetrating the polar head group … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 767 Tim44 domains in 9 757 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Tim44 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Tim44 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:

Relevant references for this domain

Primary literature for the Tim44 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Tim44 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Tim44 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR007379
PfamTim44