The STYKc domain within your query sequence starts at position and ends at position , and its E-value is < 1e-12.

MSITNGTSRSVSAMGHPAVERYTPGHIVCVGTHK
STYKc

STYKc

Protein kinase; unclassified specificity.
SMART ACC:SM000221
Description:Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 538 STYKc domains in 4 685 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing STYKc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing STYKc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the STYKc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a STYKc domain which could be assigned to a KEGG orthologous group, and not all proteins containing STYKc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain