The Alpha_kinase domain within your query sequence starts at position 1761 and ends at position 1978, and its E-value is 1e-84.

MSSWSQHGRAAMIQVLSQEEMDGGLRKAMRVISTWSEDDVLKPGQVFIVKSFLPEVVQTWYKIFQESTVLHLCLREIQQQRAAQKLIYTFNQVKPQTIPYTPRFLEVSLVYCHSANQWLTIEKYMTGEFRKYNNNNGDEIAPTNTLEELMLAFSHWTYEYTRGELLVLDLQGVGENLTDPSVIKPEDKQSRGMVFGPANLGEDAIRSFIAKHRCNSCC
Alpha_kinase

Alpha_kinase

Alpha-kinase family
SMART ACC:SM000811
Description:This family is a novel family of eukaryotic protein kinase catalytic domains, which have no detectable similarity to conventional kinases. The family contains myosin heavy chain kinases and Elongation Factor-2 kinase and a bifunctional ion channel. This family is known as the alpha-kinase family. The structure of the kinase domain revealed unexpected similarity to eukaryotic protein kinases in the catalytic core as well as to metabolic enzymes with ATP-grasp domains.
InterPro ACC:IPR004166
InterPro abstract:

This entry represents a protein kinase catalytic domain with no detectable similarity to conventional kinases that is found in eukaryotic alpha-kinases [ PUBMED:15050379 ]. This domain is shared by EF-2 kinase and the myosin heavy chain kinase A (MHCK A) [ PUBMED:9054368 expand

GO process:protein phosphorylation (GO:0006468)
GO function:protein serine/threonine kinase activity (GO:0004674), ATP binding (GO:0005524)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 220 Alpha_kinase domains in 3 201 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Alpha_kinase domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Alpha_kinase domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the Alpha_kinase domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Alpha_kinase domain which could be assigned to a KEGG orthologous group, and not all proteins containing Alpha_kinase domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamAlpha_kinase
InterProIPR004166