The VIT domain within your query sequence starts at position 1 and ends at position 131, and its E-value is 1.59e-47.

MVRSGGLLTSIRDPVALKSIAVTLSINDFVAGVSATLNYENEEKSPLEAFFVFPMDEDSAVYSFEAFVDGKKIVAELQDKYQAHKRYEEALSGGYQAYLLEEDKCSRDVFCCNVGNLQPGSKVSLTLRYVQ
VIT

VIT

Vault protein Inter-alpha-Trypsin domain
SMART ACC:SM000609
Description: -
InterPro ACC:IPR013694
InterPro abstract:

The inter-alpha-trypsin inhibitor (ITI) family is composed of protease inhibitors that are assembled from two precursor proteins: a light chain and different homologous heavy chains (ITIHs). Originally identified as plasma inhibitors, recent data indicate that ITI plays a role in extracellular matrix stabilisation and in prevention of tumour metastasis [ PUBMED:14744536 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 873 VIT domains in 1 851 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing VIT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing VIT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a VIT domain which could be assigned to a KEGG orthologous group, and not all proteins containing VIT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013694