The DBB domain within your query sequence starts at position 180 and ends at position 319, and its E-value is 8.55e-75.

MVVQPDRIRCGAETTVYIIVRCKLDEKVSTEAEFSPEDSPSIRVEGTLENEYTVSVKAPDLSSGNVSLKVYSGDLVVCETTVSYYTDMEEIGNLLSSAANPVEFMCQAFKIVPYNTETLDKLLTESLKNNIPASGLHLFG
DBB

DBB

Dof, BCAP, and BANK (DBB) motif
SMART ACC:SM001282
Description:The DBB domain is named from the Drosophila (Downstream of FGFR - Dof, also known as Heartbroken or Stumps) protein, the BANKS and BCAP, both signalling in B-cell pathway, proteins. This domain defines a minimal region required for mediating Dof dimerisation. Since this domain can interact both with itself and with a region in the C-terminal part of the molecule, it may mediate either intermolecular or intramolecular interactions PMID:12767830. Mutants lacking this domain disrupt FGFR signal transduction and fibroblast growth-factor signalling PMID:14993266.
InterPro ACC:IPR017893
InterPro abstract:

This entry represents the DBB domain.

The following proteins share a number of distinct parts, namely with ankyrin repeats a coiled coil, and a stretch of approximately 140 amino acid residues the development of the immune system in higher upstream of the ankyrin repeats, which has been called the Dof/BCAP/BANK (DBB) domain [ PUBMED:12767830 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 773 DBB domains in 773 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DBB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DBB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the DBB domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DBB domain which could be assigned to a KEGG orthologous group, and not all proteins containing DBB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDBB
InterProIPR017893