The BAH domain within your query sequence starts at position 1156 and ends at position 1272, and its E-value is 3.02e-35.

MWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAAYFYGPIFIHPEETEHEPTKMFYKKEVFLSNLEETCPMSCILGKCAVLSFKDFLSCRPTEIPENDILLCESRYNESDKQMKKFK
BAH

BAH

Bromo adjacent homology domain
SMART ACC:SM000439
Description: -
InterPro ACC:IPR001025
InterPro abstract:

The BAH (bromo-adjacent homology) is commonly found in chromatin-associated proteins [ PUBMED:23907388 ]. It is found in proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 the origin recognition complex 1 (Orc1) … expand

GO function:chromatin binding (GO:0003682)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 12 785 BAH domains in 10 544 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BAH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BAH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BAH domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BAH domain which could be assigned to a KEGG orthologous group, and not all proteins containing BAH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001025
PfamBAH