The DDT domain within your query sequence starts at position 252 and ends at position 312, and its E-value is 2.02e-23.

NEHIMNVIAIYEVVRNFGNVLRLSPFCFEDFCAALVSQEQCTLMAEMHVALLKAVLREEDT
DDT

DDT

domain in different transcription and chromosome remodeling factors
SMART ACC:SM000571
Description: -
InterPro ACC:IPR018501
InterPro abstract:

The DDT has been named after the better characterised DNA-binding homeobox- containing proteins and the Different Transcription and chromatin remodelling factors in which it is found. It is a domain of about 60 amino acids which is exclusively associated with nuclear domains like AT-Hook, PHD finger, methyl-CpG-binding domain, bromodomain and DNA-binding homeodomain.

The DDT domain is … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 151 DDT domains in 3 146 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DDT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DDT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DDT domain which could be assigned to a KEGG orthologous group, and not all proteins containing DDT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR018501