The eIF-5a domain within your query sequence starts at position 83 and ends at position 150, and its E-value is 3.83e-27.

NIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIK
eIF-5a

eIF-5a

Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
SMART ACC:SM001376
Description:eIF5A, previously thought to be an initiation factor, has been shown to be required for peptide chain elongation in yeast (PMID:9753699).
InterPro ACC:IPR020189
InterPro abstract:

A five-stranded β-barrel was first noted as a common structure among four proteins binding single-stranded nucleic acids (staphylococcal nuclease and aspartyl-tRNA synthetase) or oligosaccharides (B subunits of enterotoxin and verotoxin-1), and has been termed the oligonucleotide/oligosaccharide binding motif, or OB fold, a five-stranded β-sheet coiled to form a closed β-barrel capped by an α … expand

GO process:positive regulation of translational termination (GO:0045905), positive regulation of translational elongation (GO:0045901)
GO function:RNA binding (GO:0003723), translation elongation factor activity (GO:0003746), ribosome binding (GO:0043022)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 968 eIF-5a domains in 2 964 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing eIF-5a domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing eIF-5a domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a eIF-5a domain which could be assigned to a KEGG orthologous group, and not all proteins containing eIF-5a domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR020189
PfameIF-5a