The HTTM domain within your query sequence starts at position 56 and ends at position 315, and its E-value is 1.34e-131.

NKPTDPANLAVFRFLFAFLMLLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWMYLVYTIMFLGALGMMLGLCYRLSCVLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANHYWSVDGLLNARKKNAHVPLWNYTVLRGQIFIVYFIAGVKKLDADWVGGYSMEHLSRHWLFSPFKLVLSEELTSLLVVHWCGLLLDLSAGFLLFFDASRPVGLFFVSYFHCMNSQLFSIGMFPYVMLASSPLFCSAEW
HTTM

HTTM

Horizontally Transferred TransMembrane Domain
SMART ACC:SM000752
Description:Sequence analysis of vitamin K dependent gamma-carboxylases (VKGC) revealed the presence of a novel domain, HTTM (Horizontally Transferred TransMembrane) in its N-terminus. In contrast to most known domains, HTTM contains four transmembrane regions. Its occurrence in eukaryotes, bacteria and archaea is more likely caused by horizontal gene transfer than by early invention. The conservation of VKGC catalytic sites indicates an enzymatic function also for the other family members.
InterPro ACC:IPR011020
InterPro abstract:

Sequence analysis of vitamin K dependent gamma-carboxylases (VKGC) revealed the presence of a novel domain, HTTM (Horizontally Transferred TransMembrane). In contrast to most known domains, HTTM contains four transmembrane regions. Its occurrence in eukaryotes, bacteria and archaea is more likely caused by horizontal gene transfer than by early invention. The conservation of VKGC catalytic sites … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 048 HTTM domains in 2 048 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HTTM domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HTTM domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the HTTM domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HTTM domain which could be assigned to a KEGG orthologous group, and not all proteins containing HTTM domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR011020