The OMPdecase domain within your query sequence starts at position 253 and ends at position 466, and its E-value is 4.17e-40.

NLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMEELTALAKRHEFLIFEDRKFADIGNTVKKQYESGTFKIASWADIVNAHVVPGSGVVKGLQEVGLPLHRACLLIAEMSSAGSLATGNYTKAAVGMAEEHCEFVIGFISGSRVSMKPEFLHLTPGVQLETGGDHLGQQYNSPQEVIGKRGSDVIIVGRGILAAANRLEAAEMY
OMPdecase

OMPdecase

Orotidine 5'-phosphate decarboxylase / HUMPS family
SMART ACC:SM000934
Description:Orotidine 5'-phosphate decarboxylase (OMPdecase) (PUBMED:2835631), (PUBMED:1730672) catalyzes the last step in the de novo biosynthesis of pyrimidines, the decarboxylation of OMP into UMP. In higher eukaryotes OMPdecase is part, with orotate phosphoribosyltransferase, of a bifunctional enzyme, while the prokaryotic and fungal OMPdecases are monofunctional protein.
InterPro ACC:IPR001754
InterPro abstract:

Orotidine 5'-phosphate decarboxylase (OMPdecase) [ PUBMED:2835631 PUBMED:1730672 ] catalyses the last step in the de novo biosynthesis of pyrimidines, the decarboxylation of OMP into UMP. In higher eukaryotes OMPdecase is part, with orotate … expand

GO process:'de novo' pyrimidine nucleobase biosynthetic process (GO:0006207)
GO function:orotidine-5'-phosphate decarboxylase activity (GO:0004590)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 26 255 OMPdecase domains in 26 251 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing OMPdecase domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing OMPdecase domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the OMPdecase domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a OMPdecase domain which could be assigned to a KEGG orthologous group, and not all proteins containing OMPdecase domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001754
PfamOMPdecase