The HLH domain within your query sequence starts at position 211 and ends at position 264, and its E-value is 2.72e-16.

NLIERRRRFNINDRIKELGTLIPKSNDPEMRWNKGTILKASVDYIRKLQKEQQR
HLH

HLH

helix loop helix domain
SMART ACC:SM000353
Description: -
InterPro ACC:IPR011598
InterPro abstract:
GO function:protein dimerization activity (GO:0046983)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 86 170 HLH domains in 85 970 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HLH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HLH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the HLH domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the HLH domain.

ProteinDescriptionDisease / phenotype
MYF6_HUMANOMIM:159991 : Myopathy, centronuclear
OMIM:160150 : Becker muscular dystrophy modifier
OMIM:310200 : no description
MITF_HUMANOMIM:156845 : Waardenburg syndrome, type IIA
OMIM:193510 : Waardenburg syndrome/ocular albinism, digenic
OMIM:103470 : Tietz syndrome
OMIM:103500 : no description
TWST1_HUMANOMIM:601622 : Saethre-Chotzen syndrome
OMIM:101400 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HLH domain which could be assigned to a KEGG orthologous group, and not all proteins containing HLH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamHLH
PROSITEHELIX_LOOP_HELIX
InterProIPR011598