The AdoHcyase_NAD domain within your query sequence starts at position 372 and ends at position 533, and its E-value is 2.21e-103.

NLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTV
AdoHcyase_NAD

AdoHcyase_NAD

S-adenosyl-L-homocysteine hydrolase, NAD binding domain
SMART ACC:SM000997
Description: -
InterPro ACC:IPR015878
InterPro abstract:

S-adenosyl-L-homocysteine hydrolase ( EC:3.3.1.1 ) (AdoHcyase) is an enzyme of the activated methyl cycle, responsible for the reversible hydration of S-adenosyl-L-homocysteine into adenosine and homocysteine. AdoHcyase is an ubiquitous enzyme which binds and requires NAD + as a cofactor.AdoHcyase is a highly conserved … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 17 321 AdoHcyase_NAD domains in 17 318 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing AdoHcyase_NAD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing AdoHcyase_NAD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the AdoHcyase_NAD domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a AdoHcyase_NAD domain which could be assigned to a KEGG orthologous group, and not all proteins containing AdoHcyase_NAD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR015878
PfamAdoHcyase_NAD