The BTK domain within your query sequence starts at position 117 and ends at position 153, and its E-value is 1.89e-20.

NPHLLIKYHSGFFVDGKFLCCQQSCKAAPGCTLWEAY
BTK

BTK

Bruton's tyrosine kinase Cys-rich motif
SMART ACC:SM000107
Description:Zinc-binding motif containing conserved cysteines and a histidine. Always found C-terminal to PH domains (but not all PH domains are followed by BTK motifs). The crystal structure shows this motif packs against the PH domain. The PH+Btk module pair has been called the Tec homology (TH) region.
InterPro ACC:IPR001562
InterPro abstract:

The Btk-type zinc finger or Btk motif (BM) is a conserved zinc-binding motif containing conserved cysteines and a histidine that is present in certain eukaryotic signalling proteins. The motif is named after Bruton's tyrosine kinase (Btk), an enzyme which is essential for B cell maturation in humans and mice [ PUBMED:8070576 expand

GO process:intracellular signal transduction (GO:0035556)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 829 BTK domains in 2 827 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BTK domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BTK domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Zinc-binding

Relevant references for this domain

Primary literature for the BTK domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the BTK domain.

ProteinDescriptionDisease / phenotype
BTK_HUMANOMIM:300300 : Agammaglobulinemia, type 1, X-linked ; ?XLA and isolated growth hormone deficiency
OMIM:307200 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BTK domain which could be assigned to a KEGG orthologous group, and not all proteins containing BTK domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001562