The LRRCT domain within your query sequence starts at position 369 and ends at position 422, and its E-value is 4.15e-2.

NPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFTCR
LRRCT

LRRCT

Leucine rich repeat C-terminal domain
SMART ACC:SM000082
Description: -
InterPro ACC:IPR000483
InterPro abstract:

Leucine-rich repeats (LRR, see IPR001611 ) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [ PUBMED:14747988 ]. LRRs occur in proteins ranging from viruses to eukaryotes, and … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 43 815 LRRCT domains in 36 442 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LRRCT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LRRCT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LRRCT domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the LRRCT domain.

ProteinDescriptionDisease / phenotype
GP1BA_HUMANOMIM:231200 : Bernard-Soulier syndrome

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LRRCT domain which could be assigned to a KEGG orthologous group, and not all proteins containing LRRCT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000483