The HormR domain within your query sequence starts at position 47 and ends at position 117, and its E-value is 8.35e-25.

NQRACSGVWDNITCWRPADVGETVTVPCPKVFSNFYSRPGNISKNCTSDGWSETFPDFIDACGYNDPEDES
HormR

HormR

Domain present in hormone receptors
SMART ACC:SM000008
Description: -
InterPro ACC:IPR001879
InterPro abstract:

G protein-coupled receptors (GPCRs) constitute a vast protein family that encompasses a wide range of functions, including various autocrine, paracrine and endocrine processes. They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups [ PUBMED:12679517 ]. … expand

GO component:membrane (GO:0016020)
GO function:G protein-coupled receptor activity (GO:0004930)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 897 HormR domains in 8 701 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HormR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HormR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HormR domain which could be assigned to a KEGG orthologous group, and not all proteins containing HormR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001879