The CXC domain within your query sequence starts at position 555 and ends at position 592, and its E-value is 1.05e-1.

NRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAAD
CXC

CXC

Tesmin/TSO1-like CXC domain
SMART ACC:SM001114
Description:This family includes proteins that have two copies of a cysteine rich motif as follows: C-X-C-X4-C-X3-YC-X-C-X6-C-X3-C-X-C-X2-C. The family includes Tesmin Q9Y4I5 ((PUBMED:10191092)) and TSO1 Q9LE32 ((PUBMED:10769245)) . This family is called a CXC domain in ((PUBMED:10769245)).
InterPro ACC:IPR033467
InterPro abstract:

This entry represents a CXC domain found in proteins such as Tesmin Q9Y4I5 [ PUBMED:10191092 ] and TSO1 Q9LE32 [ PUBMED:10769245 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 8 766 CXC domains in 6 252 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CXC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CXC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the CXC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CXC domain which could be assigned to a KEGG orthologous group, and not all proteins containing CXC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR033467
PfamCXC