The RIBOc domain within your query sequence starts at position 942 and ends at position 1076, and its E-value is 1.73e-45.

NTLINIMSRLGQDDPTPSRINHNERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREV
RIBOc

RIBOc

Ribonuclease III family
SMART ACC:SM000535
Description: -
InterPro ACC:IPR000999
InterPro abstract:

This domain is found in eukaryotic, bacterial and archeal ribonuclease III (RNAse III) proteins. RNAse III is a double stranded RNA-specific endonuclease [ PUBMED:11738048 PUBMED:15016361 ]. Prokaryotic RNAse III is important in post-transcriptional … expand

GO process:RNA processing (GO:0006396)
GO function:ribonuclease III activity (GO:0004525)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 34 155 RIBOc domains in 30 210 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RIBOc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RIBOc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the RIBOc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RIBOc domain which could be assigned to a KEGG orthologous group, and not all proteins containing RIBOc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000999
PROSITERIBONUCLEASE_III
PfamRibonuclease_3