The efhand_Ca_insen domain within your query sequence starts at position 2407 and ends at position 2476, and its E-value is 6.74e-32.

NVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFV
efhand_Ca_insen

efhand_Ca_insen

Ca2+ insensitive EF hand
SMART ACC:SM001184
Description:EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes. EF hands usually bind to Ca2+ ions which causes a major conformational change that allows the protein to interact with its designated targets. This domain corresponds to an EF hand which has partially or entirely lost its calcium-binding properties. The calcium insensitive EF hand is still able to mediate protein-protein recognition (PUBMED:11573089).
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 751 efhand_Ca_insen domains in 3 743 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing efhand_Ca_insen domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing efhand_Ca_insen domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

Relevant references for this domain

Primary literature for the efhand_Ca_insen domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a efhand_Ca_insen domain which could be assigned to a KEGG orthologous group, and not all proteins containing efhand_Ca_insen domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamefhand_Ca_insen