The EGF domain within your query sequence starts at position 216 and ends at position 256, and its E-value is 4.26e0.

PCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCS
EGF

EGF

Epidermal growth factor-like domain.
SMART ACC:SM000181
Description: -
InterPro ACC:IPR000742
InterPro abstract:

This entry represents the EGF domain found in Cueball proteins, Prostaglandins and related proteins.

A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [ PUBMED:2288911 PUBMED:6334307 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 539 475 EGF domains in 145 300 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing EGF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing EGF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the EGF domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the EGF domain.

ProteinDescriptionDisease / phenotype
FBLN3_HUMANOMIM:601548 : Doyne honeycomb degeneration of retina
OMIM:126600 : no description
OMIM:126600 : Doyne honeycomb retinal dystrophy
FA9_HUMANOMIM:306900 : Hemophilia B ; Warfarin sensitivity
PROC_HUMANOMIM:176860 : Thrombophilia due to protein C deficiency ; Purpura fulminans, neonatal
FBN1_HUMANOMIM:134797 : Marfan syndrome
OMIM:154700 : Shprintzen-Goldberg syndrome
OMIM:182212 : Ectopia lentis, familial ; MASS syndrome
OMIM:604308 : no description
FA7_HUMANOMIM:227500 : Factor VII deficiency ; {Myocardial infarction, decreased susceptibility to}
FBN2_HUMANOMIM:121050 : Contractural arachnodactyly, congenital
PERT_HUMANOMIM:274500 : Thyroid iodine peroxidase deficiency ; Goiter, congenital ; Hypothyroidism, congenital
PROS_HUMANOMIM:176880 : Protein S deficiency
DLL3_HUMANOMIM:602768 : Spondylocostal dysostosis, autosomal recessive, 1
OMIM:277300 : no description
LDLR_HUMANOMIM:143890 : Hypercholesterolemia, familial

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a EGF domain which could be assigned to a KEGG orthologous group, and not all proteins containing EGF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEEGF_1
InterProIPR000742
PfamEGF