The CY domain within your query sequence starts at position 262 and ends at position 370, and its E-value is 2.96e-36.

PCPGCPRDIPVDSPELKEVLGHSIAQLNAENDHPFYYKIDTVKKATSQVVAGTKYVIEFIARETKCSKESNTELAEDCEIKHLGQSLDCNANVYMRPWENKVVPTVKCQ
CY

CY

Cystatin-like domain
SMART ACC:SM000043
Description:Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains.
InterPro ACC:IPR000010
InterPro abstract:

This entry represents the cystatin domain. Cystatins occur mainly as single-domain proteins. However, some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains.

Cystatins are cysteine proteinase inhibitors belonging to MEROPS inhibitor family I25, clan IH [ PUBMED:2107324 expand

GO function:cysteine-type endopeptidase inhibitor activity (GO:0004869)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 9 885 CY domains in 7 379 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CY domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CY domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CY domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the CY domain.

ProteinDescriptionDisease / phenotype
CYTC_HUMANOMIM:105150 : Cerebral amyloid angiopathy
OMIM:604312 : Cerebral amyloid angiopathy
OMIM:105150 : no description
CYTB_HUMANOMIM:601145 : Epilepsy, progressive myoclonic 1
OMIM:254800 : no description
FETUA_HUMANOMIM:138680 : ALPHA-2-HS-GLYCOPROTEIN; AHSG

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CY domain which could be assigned to a KEGG orthologous group, and not all proteins containing CY domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamcystatin
PROSITECY_DOMAIN
InterProIPR000010