The UDG domain within your query sequence starts at position 136 and ends at position 302, and its E-value is 1.6e-4.

PDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIK
UDG

UDG

Uracil DNA glycosylase superfamily
SMART ACC:SM000986
Description: -
InterPro ACC:IPR005122
InterPro abstract:

This entry represents various uracil-DNA glycosylases and related DNA glycosylases ( EC:3.2.2 ), such as uracil-DNA glycosylase [ PUBMED:7697717 ], thermophilic uracil-DNA glycosylase [ PUBMED:10339434 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 48 770 UDG domains in 48 764 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing UDG domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing UDG domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

Relevant references for this domain

Primary literature for the UDG domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a UDG domain which could be assigned to a KEGG orthologous group, and not all proteins containing UDG domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005122
PfamUDG