The SprT domain within your query sequence starts at position 44 and ends at position 213, and its E-value is 4.39e-72.

PDLQALFLQFNDRFFWGQLEAVEVKWSVRMTLCAGICTYEGRGGMCSIRLSEPLLKLRPRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHRINQLTGANITVYHTFHDEVDEYRRHWWRCNGPCQHRQPYYGYVKRATNRAPSVHDYWWADHQKTCGGTYIKI
SprT

SprT

SprT homologues.
SMART ACC:SM000731
Description:Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
InterPro ACC:IPR006640
InterPro abstract:

This entry represents a domain found in SprT ( P39902 ), which is a regulator of bolA gene in stationary phase [ PUBMED:13129938 ]. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 302 SprT domains in 7 300 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SprT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SprT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport
Transcription
Binding / catalysis:Possible metalloprotease

Relevant references for this domain

Primary literature for the SprT domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SprT domain which could be assigned to a KEGG orthologous group, and not all proteins containing SprT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006640