The Thymopoietin domain within your query sequence starts at position 2 and ends at position 50, and its E-value is 8.83e-30.

PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR
Thymopoietin

Thymopoietin

SMART ACC:SM001261
Description:Short protein of 49 amino acid isolated from bovine spleen cells (PUBMED:7306506). Thymopoietins (TMPOs) are a group of ubiquitously expressed nuclear proteins. They are suggested to play an important role in nuclear envelope organisation and cell cycle control (PUBMED:10430029).
InterPro ACC:IPR013146
InterPro abstract:

The LEM (LAP2, emerin, MAN1) domain is a globular module of approximately 40 amino acids, which is mostly found in the nucleoplasmic portions of metazoan inner nuclear membrane proteins. The LEM domain has been shown to mediate binding to BAF (barrier-to-autointegration factor) and BAF-DNA complexes.

GO function:DNA binding (GO:0003677)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 794 Thymopoietin domains in 783 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Thymopoietin domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Thymopoietin domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Thymopoietin domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Thymopoietin domain which could be assigned to a KEGG orthologous group, and not all proteins containing Thymopoietin domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013146
PfamThymopoietin