The CPDc domain within your query sequence starts at position 284 and ends at position 428, and its E-value is 4.19e-71.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 22050624 ) for details.

PEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDN
CPDc

CPDc

catalytic domain of ctd-like phosphatases
SMART ACC:SM000577
Description: -
InterPro ACC:IPR004274
InterPro abstract:

Yeast FCP1 is an essential protein serine phosphatase ( EC:3.1.3.16 ) that dephosphorylates the C-terminal domain (CTD) of RNA polymerase II. FCP1 orthologs are present in all known eukaryote proteomes. The N-terminal domain of FCP1 corresponds to the catalytic unit of the phosphatase and has been refered to as the FCP1 homology … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 13 391 CPDc domains in 13 352 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CPDc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CPDc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Phosphatase

Relevant references for this domain

Primary literature for the CPDc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CPDc domain which could be assigned to a KEGG orthologous group, and not all proteins containing CPDc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004274