The ZnF_TAZ domain within your query sequence starts at position 347 and ends at position 432, and its E-value is 2.31e-32.

PEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPL
ZnF_TAZ

ZnF_TAZ

TAZ zinc finger, present in p300 and CBP
SMART ACC:SM000551
Description: -
InterPro ACC:IPR000197
InterPro abstract:

TAZ (Transcription Adaptor putative Zinc finger) domains are zinc-containing domains found in the homologous transcriptional co-activators CREB-binding protein (CBP) and the P300. CBP and P300 are histone acetyltransferases ( EC:2.3.1.48 ) that catalyse the reversible acetylation of all four histones in nucleosomes, acting to … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 546 ZnF_TAZ domains in 2 838 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_TAZ domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_TAZ domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZnF_TAZ domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_TAZ domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_TAZ domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000197