The TNF domain within your query sequence starts at position 163 and ends at position 312, and its E-value is 7.37e-58.

PFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKV
TNF

TNF

Tumour necrosis factor family.
SMART ACC:SM000207
Description:Family of cytokines that form homotrimeric or heterotrimeric complexes. TNF mediates mature T-cell receptor-induced apoptosis through the p75 TNF receptor.
InterPro ACC:IPR006052
InterPro abstract:

The following cytokines can be grouped into a family on the basis of sequence, functional, and structural similarities [ PUBMED:8095800 PUBMED:1377364 PUBMED:15335677 expand

GO process:immune response (GO:0006955)
GO component:membrane (GO:0016020)
GO function:tumor necrosis factor receptor binding (GO:0005164)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 212 TNF domains in 5 186 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TNF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TNF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TNF domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the TNF domain.

ProteinDescriptionDisease / phenotype
CD40L_HUMANOMIM:308230 : Immunodeficiency, X-linked, with hyper-IgM

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TNF domain which could be assigned to a KEGG orthologous group, and not all proteins containing TNF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006052
PROSITETNF_DOMAIN
PfamTNF