The SOCS_box domain within your query sequence starts at position 481 and ends at position 517, and its E-value is 3.74e-10.

PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEY
SOCS_box

SOCS_box

SMART ACC:SM000969
Description:The SOCS box acts as a bridge between specific substrate- binding domains and more generic proteins that comprise a large family of E3 ubiquitin protein ligases.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 14 201 SOCS_box domains in 14 182 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SOCS_box domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SOCS_box domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SOCS_box domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SOCS_box domain which could be assigned to a KEGG orthologous group, and not all proteins containing SOCS_box domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamSOCS_box