The MANEC domain within your query sequence starts at position 39 and ends at position 134, and its E-value is 1.18e-39.

PGGAACLSRFTSGVPSFVLDTEASVSNGATFLGSPTARRGWDCVRSCCTTQNCNLALVELQPDGGEDAISACFLMNCLYEQNFVCKFAPKEGFINY
MANEC

MANEC

SMART ACC:SM000765
Description:The MANEC domain was formerly called MANSC. This domain, comprising 8 conserved cysteines, is found in the N terminus of higher multicellular animal membrane and extracellular proteins. It is postulated that this domain may play a role in the formation of protein complexes involving various protease activators and inhibitors. It is possible that some of the cysteine residues in the MANSC domain form structurally important disulfide bridges. All of the MANSC-containing proteins contain predicted transmembrane regions and signal peptides. It has been proposed that the MANSC domain in HAI-1 might function through binding with hepatocyte growth factor activator and matriptase.
InterPro ACC:IPR011106
InterPro abstract:

The MANSC (motif at N terminus with seven cysteines) domain is a module with a well-conserved seven cysteine motif that is present at the N terminus of higher multicellular animal membrane and extracellular proteins. It is possible that some of the cysteine residues in the MANSC domain form structurally important disulphide bridges. All of the MANSC-containing proteins contain predicted transmembrane … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 339 MANEC domains in 1 296 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MANEC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MANEC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

Relevant references for this domain

Primary literature for the MANEC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MANEC domain which could be assigned to a KEGG orthologous group, and not all proteins containing MANEC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamMANEC
InterProIPR011106