The small_GTPase domain within your query sequence starts at position and ends at position , and its E-value is < 1e-12.

PGLPEETAAKDVDYRQTALIFGSTVGFVALCSFTLMKLFKSSKF
small_GTPase

small_GTPase

Small GTPase of the Ras superfamily; ill-defined subfamily
SMART ACC:SM000010
Description:SMART predicts Ras-like small GTPases of the ARF, RAB, RAN, RAS, and SAR subfamilies. Others that could not be classified in this way are predicted to be members of the small GTPase superfamily without predictions of the subfamily.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 128 small_GTPase domains in 101 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing small_GTPase domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing small_GTPase domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:GTP hydrolysis

Relevant references for this domain

Primary literature for the small_GTPase domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a small_GTPase domain which could be assigned to a KEGG orthologous group, and not all proteins containing small_GTPase domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain