The DUF1751 domain within your query sequence starts at position 49 and ends at position 151, and its E-value is 4.14e-41.

PGYLFPPNFWIWTLATHGLMEQHVWDVAISLATVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGALAYLLTYMASFNLVYLFTIRIHGALGFLGGVLVALKQ
DUF1751

DUF1751

Eukaryotic integral membrane protein (DUF1751)
SMART ACC:SM001160
Description:This domain is found in eukaryotic integral membrane proteins. Q12239 a Saccharomyces cerervisiae protein, has been shown to localise COP II vesicles [(PUBMED:14562095)].
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 423 DUF1751 domains in 1 422 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF1751 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF1751 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF1751 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF1751 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

PfamDUF1751